PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0770
Common NameMYBA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 247aa    MW: 28794.4 Da    PI: 6.9362
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0770genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.7e-181057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ll+++++++G g W+ ++++ g++R++k+c++rw++yl
      Gh_D07G0770 10 KGAWTEEEDLLLKKCIEKYGEGKWHQVPARAGLNRCRKSCRLRWLNYL 57
                     79********************************************97 PP

2Myb_DNA-binding45.61.6e-1463108148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg + ++E +l+++++++lG++ W++Ia +++ gRt++++k++w+++l
      Gh_D07G0770  63 RGHFAADEVDLIIRLHNLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
                      6778899***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.367561IPR017930Myb domain
SuperFamilySSF466895.62E-297104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-23759IPR009057Homeodomain-like
SMARTSM007174.2E-16959IPR001005SANT/Myb domain
PfamPF002494.5E-171057IPR001005SANT/Myb domain
CDDcd001671.83E-111257No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2260111IPR009057Homeodomain-like
PROSITE profilePS5129417.61662112IPR017930Myb domain
SMARTSM007172.9E-1362110IPR001005SANT/Myb domain
PfamPF002492.8E-1363108IPR001005SANT/Myb domain
CDDcd001672.79E-968108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEGSSLRVRK GAWTEEEDLL LKKCIEKYGE GKWHQVPARA GLNRCRKSCR LRWLNYLKPN  60
IKRGHFAADE VDLIIRLHNL LGNRWSLIAG RLPGRTANDV KNYWNTHLLK KNIDTFTKTS  120
NPKSHQLKPN TKVIKPRPQI LSKRSFLVNL DEYNNNNNNN NRAETSNNVV LANCGDNHDG  180
YCFPDHDEIM WWENMMMNEK EVDGHQLQCS ANDIDESVLD QIMNEDNFGN TMDELFLDEE  240
PWNVFNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-22101157110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.209450.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7494310.0KF749431.1 Gossypium hirsutum cultivar Xincaimian 5 myb-related transcription factor A1 (MYBA1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012471874.11e-172PREDICTED: transcription factor MYB113-like isoform X1
SwissprotQ9FNV94e-64MY113_ARATH; Transcription factor MYB113
TrEMBLW5RZS40.0W5RZS4_G
STRINGVIT_02s0033g00410.t013e-68(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-64myb domain protein 113